PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zmw_sc12461.1.g00010.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family TCP
Protein Properties Length: 157aa    MW: 16550.6 Da    PI: 6.3549
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zmw_sc12461.1.g00010.1genomeZGD-
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP99.36.9e-3163130673
                           TCP   6 drhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssasec 73 
                                    rh ++hTkv+gR+RR+Rl   caar+  L++eLG++ d++t+ WLlqq++pa++++tgt++ +a ++
  Zmw_sc12461.1.g00010.1.am.mk  63 PRHRDRHTKVEGRGRRIRLAEACAARIARLTRELGHKNDGETVRWLLQQSEPAVIAATGTGTVPAIAT 130
                                   69**********************************************************77777333 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF036345.4E-2565132IPR005333Transcription factor, TCP
PROSITE profilePS5136921.5265119IPR017887Transcription factor TCP subgroup
Sequence ? help Back to Top
Protein Sequence    Length: 157 aa     Download sequence    Send to blast
MGEEDVAAIY HAAGNGTAVT DEAVVGIDAM GSSEAHGSLM PKPEPAPMEF LGELQVANPR  60
PAPRHRDRHT KVEGRGRRIR LAEACAARIA RLTRELGHKN DGETVRWLLQ QSEPAVIAAT  120
GTGTVPAIAT TVDGVLRLPS SPPAAVADGD QQPDPKR
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004957394.13e-62PREDICTED: transcription factor PCF2-like
SwissprotA2YXQ18e-48PCF2_ORYSI; Transcription factor PCF2
SwissprotQ6ZBH68e-48PCF2_ORYSJ; Transcription factor PCF2
TrEMBLK3ZVG02e-62K3ZVG0_SETIT; Uncharacterized protein
STRINGSi030591m7e-62(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP39123167